La descarga está en progreso. Por favor, espere

La descarga está en progreso. Por favor, espere

¿Por qué es útil la comparación de secuencias? Parte II Lipman, David (NIH/NLM/NCBI)

Presentaciones similares


Presentación del tema: "¿Por qué es útil la comparación de secuencias? Parte II Lipman, David (NIH/NLM/NCBI)"— Transcripción de la presentación:

1 ¿Por qué es útil la comparación de secuencias? Parte II Lipman, David (NIH/NLM/NCBI)

2 Casi 100 Trillones de comparaciones BLAST por cuarto (10/01)

3 Búsqueda rápida de similitudes de banco de datos de ácido nucleico y proteínas. Wilbur WJ, Lipman DJ. Proc Natl Acad Sci U S A 1983 Feb;80(3): Con el desarrollo de grandes bancos de datos de secuencias de proteínas y ácidos nucleicos, la necesidad de métodos eficientes de búsqueda en tales bancos para secuencias similares a una secuencia dada se ha vuelto evidente. Presentamos un algoritmo para la comparación global de secuencias basados en k-tuples pareados de secuencia de elementos para un k fijado. El método resulta en reducción substancial del tiempo requerido para la búsqueda en el banco de datos cuando se compara con técnicas anteriores de análisis de similitud, con mínima pérdida de sensibilidad. El algoritmo también ha sido adaptado, en una implementación separada, para producir alineación rigurosa de secuencias. Actualmente, usando el sistema DEC KL-10, podemos comparar todas las secuencias en el Banco de datos de proteína de la Fundación de Investigación Biomédica con una búsqueda de secuencia 350- residuos en menos de 3 minutos y efectuar un análisis similar con un búsqueda de secuencia 500-base contra todas las secuencias eucarióticas en la Báse de Datos de Ácido Nucleico en los Álamos en menos de 2 minutos.

4 Gene del cáncer encuentra su pareja NY Times Julio 3, 1983 …una búsqueda computarizada por serendipia… v-sis: 6 QGDPIPEELYKMLSGHSIRSFDDLQRLLQGDSGKEDGAELDLNMTRSHSGGELESLARGK 65 QGDPIPEELY+MLS HSIRSFDDLQRLL GD G+EDGAELDLNMTRSHSGGELESLARG+ PDGF : 10 QGDPIPEELYEMLSDHSIRSFDDLQRLLHGDPGEEDGAELDLNMTRSHSGGELESLARGR 69 v-sis: 66 RSLGSLSVAEPAMIAECKTRTEVFEISRRLIDRTNANFLVWPPCVEVQRCSGCCNNRNVQ 125 RSLGSL++AEPAMIAECKTRTEVFEISRRLIDRTNANFLVWPPCVEVQRCSGCCNNRNVQ PDGF : 70 RSLGSLTIAEPAMIAECKTRTEVFEISRRLIDRTNANFLVWPPCVEVQRCSGCCNNRNVQ 129 v-sis: 126 CRPTQVQLRPVQVRKIEIVRKKPIFKKATVTLEDHLACKCEIVAAARAVTRSPGTSQEQR 185 CRPTQVQLRPVQVRKIEIVRKKPIFKKATVTLEDHLACKCE VAAAR VTRSPG SQEQR PDGF : 130 CRPTQVQLRPVQVRKIEIVRKKPIFKKATVTLEDHLACKCETVAAARPVTRSPGGSQEQR 189 v-sis: 186 AKTTQSRVTIRTVRVRRPPKGKHRKCKHTHDKTALKETLGA 226 AKT Q+RVTIRTVRVRRPPKGKHRK KHTHDKTALKETLGA PDGF : 190 AKTPQTRVTIRTVRVRRPPKGKHRKFKHTHDKTALKETLGA 230 V-sis y factor de crecimiento derivado de plaquetas (PDGF) Waterfield MD et al., Nature 1983 Jul 7;304(5921):35-39 Doolittle RF et al., Science 1983 Jul 15;221(4607):

5 Un temprano, más sutil descubrimiento … Productos del gene viral src están relacionados a la cadena catalítica de proteìn-kinasa dependiente de cAMP de mamíferos Barker WC, Dayhoff MO. PNAS 1982 Mayo;79(9): Query: 113 YAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQGYIQVTDFGFAKR---VKGRTWT---LC 166 Y+ +V +LHS +++ DLKP N+LI +Q +++DFG GR + + Sbjct: 125 YSLDVVNGLLFLHSQSILHLDLKPANILISEQDVCKISDFGCSQKLQDLRGRQASPPHIG 184 Query: 167 GTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVR 223 GT + APEI+ + D ++ G+ +++M P ++ +P + +V+ +R Sbjct: 185 GTYTHQAPEILKGEIATPKADIYSFGITLWQMTTREVP-YSGEPQYVQYAVVAYNLR 240 Biología no algoritmos - Comparan proteínas, no DNA - deberá detectar aminoácidos similares no sólo identidades (para animación de la diapositiva, por favor de click en el área de la diapositiva p en el botón de mostrar la diapositiva).

6 ¿Con qué frecuencia encontraremos similitudes? ¿Cuántas familias de proteínas habrá? Similitudes inesperadas deberán ser raras. En 1983, hubo sólo un pequeño porcentaje de genes de los genomas de distintos organismos, diferentes en su evolución (por ejemplo hombre, mosca, e. coli, levadura ). (para animación de la diapositiva, por favor de click en el área de la diapositiva p en el botón de mostrar la diapositiva).

7 Estimando el número de familias de proteínas (para animación de la diapositiva, por favor de click en el área de la diapositiva p en el botón de mostrar la diapositiva).

8 Estimaciones tempranas del número de familias de proteínas- ~1000 Zuckerkandl,E. (1974) Accomplissement et perspectives de la paleogenetique chimique. In: Ecole de Roscoff –1974, p. 69. Paris:CNRS. La aparición de nuevas estructuras y funciones en proteínas durante evolución, J. Mol. Evol. 7, 1-57 (1975). Dayhoff, M.O. (1974) Federation Proceedings 33, El origen y evolución de superfamilias de proteínas, Fed.Proc. 35, (1976).

9 Margaret Dayhoff

10 Atlas de Secuencia y Estructura de Proteína, Vol. 5, Suplemento 3 (1978) pg. 10: Se ha estimado que en el humano hay 50,000 proteínas de importancia funcional o médica. … Un hito en la biología molecular ocurrirá cuando un miembro de cada superfamilia haya sido elucidado. A la tasa actual de 25 por año, tomará al menos 15 años.

11 Hubris, el Proyecto Genoma y familias de proterínas Chothia, C. (1992). Mil familias para el biólogo molecular. Nature, 357, Green P, Lipman D, Hillier L, Waterson R, States,D, and Claverie JM (1993). Ancient Conserved Regions in New Gene Sequences and the Protein Databases. Science, 259, ACR = similitud detectada entre secuencias de organismos remotamente relacionados (Para animación de la diapositiva click en el área de la diapositiva o el botón de mostrar diapositiva)

12 1992: ¿Qué nuevas familias tenemos del proyecto genoma? SetN Codificación de secuencias Sec. con ACRs ACRs humano ESTs (16- 33%) 103 gusano ESTs (42%)240 Genes gusano (32%)59 Levadura ORFs (24%)35 Sets comparadosSecuencias pareadas ACRsACRs en base de datos gusano ESTs, humano ESTs77, (91%) gusano ESTs, levadura ORFs23, 1398 (89%) gusano genes, humano ESTs17, (100%) gusano genes, levadura ORFs6, 443 (75%) humano ESTs, levadura ORFs14, (100%) (Para animación de la diapositiva click en el área de la diapositiva o el botón de mostrar diapositiva)

13 * * * * * * Número de proteínas Familias con dominio conservado Secuencias de proteínas % Familias Hit Dayhoff 10% de superfamilias Green et al. 85% de ACRs Crecimiento acumulado en número de proteínas y número de dominios conservados (de Geer, L., Bryant, S., & Ostell, J.) (Para animación de la diapositiva click en el área de la diapositiva o el botón de mostrar diapositiva)

14 ¿Por qué son pocas familias y por qué evolucionan lentamente? Vista estructural Termodinámica: Finkelstein, AV, ¿Por qué aon las mismas proteínas usadas para realizar diferentes funciones? FEBS 325, pp (1993) TípicaMuy rara

15 Limitantes debido a función biológica pueden ser más importantes procariotes eucariotes Compare pares de secuencias de clases relacionadas de proteínas Grado dentro de clases similares > entre clases similares indica importancia de limitantes debido a función biológica – Todas las secuencias deberían al menos compartir similitudes en la estructura – Secuencias dentro de una clase comparten función pero las secuencias entre clases tienen diferente función –Los tiempos de divergencia para todas las secuencias deben ser aproximadamente las mismas Divergencia funcional Un gen Duplicación de genes Último ancestro universal común (para animación de la diapositiva click el área de la diapositiva o click en Mostrar Diapositiva)

16 Dos clases no relacionadas de aaRS, cada una incluye 10 aaRS relacionadas entre sí El último ancestro común universal (LUCA) de formas de vida moderna ya tenía al menos 17 aaRS La duplicación que da lugar a aaRS de diferentes especificidades debió haber ocurrido durante un relativamente corto periodo de evolución temprana. La evolución post-LUCA de aaRS tomó mucho más que la fase temprana cuando las especificidades fueron establecidas. Sin embargo, los cambios que ocurrieron después de aaRS fueron cerradas en sus especificidades son pequeños comparados a los cambios trazados en la fase temprana. Ejemplo de la aminoacil-tRNA sintestasas (aaRS) (de E. Koonin & Y. Wolf) enzimas esenciales responsables para la incorporación de aminoácidos en proteínas (para animación de la diapositiva click el área de la diapositiva o click en Mostrar Diapositiva)

17 Orthologs … (de S. Bryant )

18 Paralogs … (de S. Bryant )

19 Ejemplo de las aminoacil-tRNA sintetasas (aaRS) (de E. Koonin & Y. Wolf) Exepciones - glutamina/glutamato,asparagina/ aspartato y triptofano/tirosina

20 ¿Cuantos genes humanos? 80,000 Antequera F & Bird A, Number of CpG islands and genes in human and mouse, PNAS 90, (1993). 120,000 Liang F et al., Gene Index analysis of the human genome estimates approximately 120,000 genes, Nat. Gen., 25, (2000) 35,000 Ewing B & Green P, Analysis of expressed sequence tags indicates 35,000 human genes, Nat. Gen. 25, (2000) 28,000-34,000 Roest Crollius, H. et al., Estimate of human gene number Provided by genome-wide analysis using Tetraodon nigroviridis DNA Sequence, Nat. Gen. 25, (2000). 41,000-45,000 Das M et al., Assessment of the Total Number of Human Transcription Units, Genomics 77, (2001) (para animación de la diapositiva click el área de la diapositiva o click en Mostrar Diapositiva)

21 ¿Cuantos genes humanos con ACRs? (de S. Resenchuk, T.Tatusov, L. Wagner, A. Souverov) 12,245 mRNA caracterizados de RefSeq 78% tienen ACR, i.e., vertebrados en E <10e-6 ( 9,496/12,245) 90% de estos han correspondido a predicciones de GenomeScan los cuales también tienen ACR (8501/9496) 20,245 modelos GS para el genoma humano completo tienen ACR 15,573 modelos GS después de corrección para splitting (20,245/1.3) 17,300 genes humanos estimados con ACRs ( ~15,573/.9) (para animación de la diapositiva click el área de la diapositiva o click en Mostrar Diapositiva)

22 ¿Cuantos genes tienen los humanos? S.cerev.S. PombeA.thal.C. ElegansD. mela. ACRs/ genes 4022/ % 4846/ % 14443/ % 11598/ % 10469/ % 17,303 estimación de genes humanos con ACRs 17,303/.55 = ~31,500 Total de genes humanos ¡Más complicado que esto! Ahora use comparación de genomas… (para animación de la diapositiva click el área de la diapositiva o click en Mostrar Diapositiva)

23 Conservación, nivel de expresión longitud de proteína y número exon EST # >200All RefSec # ,245 RS + ACR 240 (61%) 1718 (63%) 7049 (75%) 2447 (88%) 9496 (78%) GS + ACR 158 (66%) 1424 (83%) 6256 (89%) 2245 (92%) 8501 (90%) Long. de Prot Avg. exon# ,600 estimación revisada de genes humanos con ACRs (~15,573/.66) 43,000 límite superior del estimado del total de genes humanos (23,600/.55) 35,000 es un límite más razonable con esta forma (para animación de la diapositiva click el área de la diapositiva o click en Mostrar Diapositiva)

24 La relación de conservación de proetína y longitud de secuencia Lipman DJ, Souvorov A, Koonin EV, Panchenko AR, Tatusova TA BMC Evol Biol :20

25 conservada No conservada Dominios estructurales Set de Salmonella 4279 proteínas Longitud Número

26 Archaeoglobus fulgidus Número Longitud 2420 proteínas conservada No conservada Dominios estructurales

27 conservada No conservada Dominios estructurales

28 Drosophila Número 2390 proteínas conservada No conservada Dominios estructurales Longitud

29 Humano Número Longitud proteínas Conservada No conservada Dominios estructurales

30 Conservada No conservada A B

31 Archaeoglobus fulgidus Escherichia coli Densidad de contacto

32 Reconocimientos Steve BryantGreg Schuler Lewis GeerAlex Souverov Alex KondrashovTatiana Tatusov Eugene KooninLukas Wagner Jim OstellYuri Wolf Sergei ResenchukPhil Murphy (NIAID) Y todos mis colegas en NCBI y NIH


Descargar ppt "¿Por qué es útil la comparación de secuencias? Parte II Lipman, David (NIH/NLM/NCBI)"

Presentaciones similares


Anuncios Google