La descarga está en progreso. Por favor, espere

La descarga está en progreso. Por favor, espere

Aplicaciones Biológicas de la Espectrometría de Masa Matías Möller.

Presentaciones similares


Presentación del tema: "Aplicaciones Biológicas de la Espectrometría de Masa Matías Möller."— Transcripción de la presentación:

1 Aplicaciones Biológicas de la Espectrometría de Masa Matías Möller

2 2 MS/MS Espectrometría en Tándem: Secuenciación de péptidos Espectrometría de masa

3 3 MS/MS: Espectrometría en Tándem Espectrometría de masa Seleccionar uno de los iones de la muestra, fragmentarlo y estudiar la formación de iones hijos m p + m d + + m n 0 Aplicaciones: Identificación de moléculas Secuenciación de péptidos al vuelo Modificaciones posttraduccionales

4 4 MS/MS: Espectrometría en Tandem Espectrometría de masa ESI-Q Q 1 Q 2 Q 3 : Triple Cuadrupolo. Q 1 y Q 3 separan iones moleculares, mientras Q 2 sirve de cámara de colisión: Se introduce un gas para que los iones acelerados choquen y se fragmenten CID: Collision Induced Dissociation Se usa mucho para realizar cuantificaciones por LC-MS-MS

5 Mass Analysis peptides protein peptides Ionization Digestion m/z MS

6 IonizationIsolationFragmentation Mass Analysis protein peptide fragments Digestion peptides m/z MSMS/MS m/z Isolation

7 MS/MS Select Parent Fragment Analyse Fragment Masses Analyse Parent Masses MS Tandem en el espacio

8 8 MS/MS Secuenciación peptídica Espectro MS/MS: masa de los fragmentos Mezcla de péptidos MS/MS péptido seleccionado para MS/MS Espectro MS Carlos Cerveñansky

9 9 MS/MS: Espectrometría en Tandem ESI-IT IT: Trampa de Iones La trampa de iones puede analizar los iones de una muestra MS También puede seleccionar uno, y concentrarlo en la trampa Luego se introduce Helio para que los iones acelerados choquen y se fragmenten Luego se analizan los iones hijo CID: Collision Induced Dissociation Las trampas de iones tienen capacidad de hacer MS n se seleccionan iones hijo se fragmentan, analizan, seleccionan uno fragmentan, analizan, seleccionan uno hasta que les de la sensibilidad MS 2

10 Fragment Isolate Parent Ion Intact ions Intact ion Daughters This analysis/isolation/fragmentation can be carried out in an ion trap Tandem en el tiempo

11 11 MS/MS: Espectrometría en Tandem Espectrometría de masa MALDI-TOF Iones moleculares que se fragmentan durante el vuelo llegan juntos al reflector y pueden ser analizados por el mismo. PSD: Post Source Decay

12 ESQUEMA: Instrumento de tecnología MALDI-TOF

13 N-terminal C-terminal

14 y ionsb ions b1 b2 b3 b4 y4 y3 y2 y1

15 b1b1 b2b2 b3b3 y1y1 y2y2 y3y3 LF K G GL K F Relative Intensity m/z FLGK ++ FLGK ++ FLGK ++ CID FLGK ++ FLGK ++ FLGK ++ b1b1 b2b2 b3b3 y3y3 y2y2 y1y1 FLGK ++ FLGK +

16 Peptide Fragmentation by MS/MS Relative Abundance y9 b m/z y13 y12 y12* y11 y10 y8 y7 b13 b12 b11 b10 b8 b7 b6 b5 b6* b5* a5 a12 His-Gly-Thr-Val-Val-Leu-Thr-Ala-Leu-Gly-Gly-Ile -Leu-Lys b1b4b3b5b6b7b8b9b10b2b11b12b13 y13y10y11y9y8y7y6y5y4y12y3y2y1

17 17

18 18

19 19 MS/MS: Espectrometría en Tandem Espectrometría de masa Fragmentación peptídica

20

21

22 22 Identificación de proteínas Peptide mass fingerprinting y proteomica

23 23 Identificación de proteínas

24 Mapeo peptídico por EM (Peptide Mass Fingerprinting/MS) MEMEKEFEQIDKSGSWAAIYQDIRHEASDFPCRVAKLPKNKNRNRYRDVS PFDHSRIKLHQEDNDYINASLIKMEEAQRSYILTQGPLPNTCGHFWEMVW EQKSRGVVMLNRVMEKGSLKCAQYWPQKEEKEMIFEDTNLKLTLISEDIK SYYTVRQLELENLTTQETREILHFHYTTWPDFGVPESPASFLNFLFKVRE SGSLSPEHGPVVVHCSAGIGRSGTFCLADTCLLLMDKRKDPSSVDIKKVL LEMRKFRMGLIQTADQLRFSYLAVIEGAKFIMGDSSVQDQWKELSHEDLE PPPEHIPPPPRPPKRILEPHNGKCREFFPNHQWVKEETQEDKDCPIKEEK GSPLNAAPYGIESMSQDTEVRSRVVGGSLRGAQAASPAKGEPSLPEKDED HALSYWKPFLVNMCVATVLTAGAYLCYRFLFNSNT proteína intacta enzima proteolítica péptidos

25 Mass (m/z) 0 6.0E % Intensity Voyager Spec #1=>BC=>NF0.9[BP = , 60367] Espectro de masa del citocromo c de caballo A. Molécula entera. Matriz: ácido sinapínico

26 Mass (m/z) 0 2.0E % Intensity Voyager Spec #1=>MC=>BC[BP = , 19883] B. Molécula digerida con tripsina. Matriz: ácido -ciano hidroxicinámico

27 Niveles de información……… en la caracterización de proteínas por MS. medida de masa de una molécula entera 1 valor experimental medidas de masas en mapeo peptídico 5-20 valores experimentales secuenciado de péptidos por MS/MS más de 100 valores experimentales …mejora en cantidad y calidad de la información

28 Peptide fragmentation fingerprinting Enzymatic digestion In-silico digestion Protein(s)Peptides MS/MS spectra of peptides Ions peaklists …MAIILAGGHSVRFGPKAF AEVNGETFYSRVITLESTNM FNEIIISTNAQLATQFKYPN VVIDDENHNDKGPLAGIYTI MKQHPEEELFFVVSVDTPMI TGKAVSTLYQFLV … - MAIILAGGHSVR - FGPK - AFAEVNGETFYSR - VITLESTNMFNEIIIK - YPNVVIDDENNDK … Sequence database entry Theoretical peaklist Theoretical proteolytic peptides Match Result: ranked list of peptide and protein candidates Theoretical fragmented peptides -MAIILAG -MAIILA -MAIIL -MAII -MAI -M -AIILAG In-silico fragmentation PFF = ion search MS/MS database matching

29

30 Proteoma Producto final del genoma más variedad Es una entidad dinámica Fenotipo Modificaciones posttraduccionales No todos los genes se expresan como proteínas en todos los estadios/tipos celulares

31 1 gen = 1proteina? 1 gen ya no equivale a una proteina La definición de gen es debatible (ORF, promotor, pseudogen, producto de gen, etc) 1 gen = cuántas proteinas? (no sabemos)

32 Sujetos de estudio de la Proteómica Identificación de Proteínas (pept mass fingerprint) Comparación de niveles de expresión de Proteinas Función de Proteinas Modificaciones posttraduccionales de Proteinas Localización y Compartimentalización de Proteinas Interacciones Proteina-Proteina

33

34

35 Quantitative proteomics

36

37

38 Identificación de sitios de modificación Oxidación de citocromo c Y74 Y67 Y48 Y97 Y74 Y67 Y48 Y97 Located in mitochondria, plays an important role in apoptosis intrinsic pathway and has been linked to oxidative stress responses

39 [H 2 O 2 ] 37°C,1 Hr aPLPC TOCL

40 b10 y9 b8 b7 b6 y5 y4 b5 y7 (2+) y5 (2+) y6 (2+) b7-CO (2+) y12 y11 y10 y9 y8 y7 y6 y5 y4 y3 y2 y1 T---E---R---E---D---L---I---A---Y*--L---K---K b1 b2 b3 b4 b5 b6 b7 b8 b9 b10 b11 b12 Y+16

41 GAPDH Reaction with Nitro-oleic acid Batthyany J.Biol.Chem. 2006, p.20450

42 MS-Imaging

43

44

45

46

47 Mass is given as m/z which is the mass of the ion divided by its charge Monoisotopic mass is the mass of an ion for a given empirical formula calculated using the exact mass of the most abundant isotope of each element (C= , H= etc) Average mass is the mass of an ion for a given empirical formula calculated using the average exact mass for each element (C= , H= etc) Nominal mass is the mass of an ion for a given empirical formula calculated using the integer mass of the most abundant isotope for each element (C=12, H=1 etc)

48

49 Electrospray Ionisation and Charge

50 Determining Charge State

51 Double Charge State Delta = 0.5 amu Determining Charge State Delta = 0.5 amu


Descargar ppt "Aplicaciones Biológicas de la Espectrometría de Masa Matías Möller."

Presentaciones similares


Anuncios Google